PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013628391.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 340aa    MW: 38263.7 Da    PI: 6.5064
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013628391.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-153279148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
   XP_013628391.1 32 KGLWSPDEDERLIRYMLTNGQGCWSDIARNAGLLRCGKSCRLRWINYL 79
                     678*****************************99************97 PP

2Myb_DNA-binding48.71.7e-1585129147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l+++ +  lG++ W+ Ia +++ gRt++++k++w++ 
   XP_013628391.1  85 RGAFSPQEEDLIIHFHSILGNR-WSQIATRLP-GRTDNEIKNFWNST 129
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4312779IPR017930Myb domain
SuperFamilySSF466891.37E-2729126IPR009057Homeodomain-like
SMARTSM007174.1E-123181IPR001005SANT/Myb domain
PfamPF002497.1E-143279IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-223386IPR009057Homeodomain-like
CDDcd001677.13E-103579No hitNo description
PROSITE profilePS5129423.80380134IPR017930Myb domain
SMARTSM007172.5E-1584132IPR001005SANT/Myb domain
PfamPF002492.6E-1485129IPR001005SANT/Myb domain
CDDcd001678.53E-1187130No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2487133IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MMMRNQDITT IRDKKKPNHA CGGSNNKPKL RKGLWSPDED ERLIRYMLTN GQGCWSDIAR  60
NAGLLRCGKS CRLRWINYLR PDLKRGAFSP QEEDLIIHFH SILGNRWSQI ATRLPGRTDN  120
EIKNFWNSTL KKRFKNNNNN TSSGSSPNNS NSNSLDLRDQ HVEMGGKSNS MMGSYHHQHD  180
DMMIMGNTMG MDSSSFHFAP VVSGVGLNQL DPLISVPDHS QYQQMGNTGN VFNVNGLGDY  240
GNAILDPISK RASVESEWFL PASENINSIP CTTSNNLNVE VLDPCFNSKT MCHSESFKVG  300
NMFGMENASW ETENPKIGDW DLDGLIDDNS SFPFLDFQVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-282813423128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11431KKPNHACGGSNNKPKLRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013628391.10.0PREDICTED: transcription factor TT2
RefseqXP_013684620.10.0PREDICTED: transcription factor TT2-like
TrEMBLA0A0D3BAA00.0A0A0D3BAA0_BRAOL; Uncharacterized protein
STRINGBra001284.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70772642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-178myb domain protein 83